General Information

    • DRAMP ID

    • DRAMP01641

    • Peptide Name

    • Dermaseptin-3 (DShypo03; Frogs, amphibians, animals)

    • Source

    • Phyllomedusa hypochondrialis (Orange-legged leaf frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ALWKDVLKKIGTVALHAGKAAFGAAADTISQGGS

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01641 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01641.

Physicochemical Information

    • Formula

    • C151H246N42O44

    • Absent Amino Acids

    • CEMNPRY

    • Common Amino Acids

    • A

    • Mass

    • 3353.87

    • PI

    • 9.53

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +3

    • Boman Index

    • -4.61

    • Hydrophobicity

    • 0.318

    • Aliphatic Index

    • 97.94

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 166.67

    • Polar Residues

    • 9

DRAMP01641

DRAMP01641 chydropathy plot

Comments Information

    • Function

    • May have antimicrobial activity.

Literature Information

  • ·Literature 1

    • Title

    • Novel dermaseptins from Phyllomedusa hypochondrialis (Amphibia).

    • Reference

    • Biochem Biophys Res Commun. 2006 Sep 1;347(3):739-746.

    • Author

    • Brand GD, Leite JR, de Sá Mandel SM, Mesquita DA, Silva LP, Prates MV, Barbosa EA, Vinecky F, Martins GR, Galasso JH, Kuckelhaus SA, Sampaio RN, Furtado JR Jr, Andrade AC, Bloch C Jr.