• • DRAMP ID

  • DRAMP01649

• • Peptide Name

  • Dermaseptin-BI (Dermaseptin B1; Frogs, amphibians, animals)

• • Source

  • Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)

• • Family

  • Belongs to the frog skin active peptide family (Dermaseptin subfamily)

• • Gene

  • Not found

• • Sequence

  • AMWKDVLKKIGTVALHAGKAALGAVADTISQ

• • Sequence Length

  • 31

• • UniProt Entry

  • P80282

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-negative bacterium: Escherichia coli (IP 76-24) (MIC=15 µg/ml);
    • Gram-positive bacterium: Nocardia brasiliensis (IP 16-80) (MIC=30 µg/ml).
    • Fungi: Tricophyton rubrum (IP 1400-82) (MIC=15 µg/ml), Microsporum canis (IP 1194) (MIC=10µg/ml), Arthroderma simii (IP 1063-74) (MIC=30 µg/ml), Cryptococcus neoformans (IP 960-67) (MIC=15 µg/ml), Cryptococcus neofonnans (IP 962-67) (MIC=15 µg/ml), Aspergillus fumigatus (IP 1025-70)(MIC=125 µg/ml), Aerornonas caviae (IP 67-16 T) (MIC=60 µg/ml), Candida albicans (IP 884-65) (MIC=15 µg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Amidation

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP01649_predicted_structure.pdb to download.

DRAMP01649

• • Function

  • Possesses a potent antimicrobial activity against bacteria, fungi and protozoa. Probably acts by disturbing membrane functions with its amphipathic structure.

• • Tissue specificity

  • Expressed by the skin glands.

• • PTM

  • C-terminal amidation (Potential).

• ·Literature 1

• • Title

  • Isolation and structure of novel defensive peptides from frog skin.

• • Pubmed ID

  • 8306981

• • Reference

  • Eur J Biochem. 1994 Jan 15;219(1-2):145-154.

• • Author

  • Mor A, Nicolas P.

• ·Literature 2

• • Title

  • Precursors of vertebrate peptide antibiotics dermaseptin b and adenoregulin have extensive sequence identities with precursors of opioid peptides dermorphin, dermenkephalin, and deltorphins.

• • Pubmed ID

  • 8074751

• • Reference

  • J Biol Chem. 1994 Jul 8;269(27):17847-17852.

• • Author

  • Amiche M, Ducancel F, Mor A, Boulain JC, Menez A, Nicolas P.