General Information

    • DRAMP ID

    • DRAMP01657

    • Peptide Name

    • Dermaseptin DRG3 (Dermaseptin-3; Frogs, amphibians, animals)

    • Source

    • Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)

    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)

    • Gene

    • DRG3

    • Sequence

    • ALWKTIIKGAGKMIGSLAKNLLGSQAQPES

    • Sequence Length

    • 30

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • Several species of mollicutes (MIC=6.25-100 µM), firmicutes (MIC=6.25-100 µM), gracilicutes (MIC=6.25-100 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01657 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01657.

Physicochemical Information

    • Formula

    • C139H236N38O40S

    • Absent Amino Acids

    • CDFHRVY

    • Common Amino Acids

    • AGKL

    • Mass

    • 3111.69

    • PI

    • 10

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +3

    • Boman Index

    • -9.38

    • Hydrophobicity

    • 0.033

    • Aliphatic Index

    • 104.33

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 189.66

    • Polar Residues

    • 9

DRAMP01657

DRAMP01657 chydropathy plot

Comments Information

    • MOA

    • This peptide is membranotropic and it efficiently depolarizes the plasma membrane.

Literature Information

  • ·Literature 1

    • Title

    • Synthesis, antimicrobial activity and gene structure of a novel member of the dermaseptin B family.

    • Reference

    • Biochim Biophys Acta. 1998 Mar 9;1396(2):228-236.

    • Author

    • Fleury Y, Vouille V, Beven L, Amiche M, Wróblewski H, Delfour A, Nicolas P.