• DRAMP ID

    • DRAMP01683
    • Peptide Name

    • Dermaseptin-S11 (DS11; Frogs, amphibians, animals)
    • Source

    • Phyllomedusa sauvagei (Sauvage's leaf frog)
    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)
    • Gene

    • Not found
    • Sequence

    • ALWKTLLKGAGKVFGHVAKQFLGSQGQPES
    • Sequence Length

    • 30
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01683 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01683.
    • Formula

    • C147H232N40O39
    • Absent Amino Acids

    • CDIMNRY
    • Common Amino Acids

    • G
    • Mass

    • 3183.7
    • PI

    • 10
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +4
    • Boman Index

    • -13.48
    • Hydrophobicity

    • -0.167
    • Aliphatic Index

    • 81.33
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 189.66
    • Polar Residues

    • 8

DRAMP01683

DRAMP01683 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Dermaseptin S9, an alpha-helical antimicrobial peptide with a hydrophobic core and cationic termini.
    • Reference

    • Biochemistry. 2006 Jan 17;45(2):468-480.
    • Author

    • Lequin O, Ladram A, Chabbert L, Bruston F, Convert O, Vanhoye D, Chassaing G, Nicolas P, Amiche M.