General Information

    • DRAMP ID

    • DRAMP01683

    • Peptide Name

    • Dermaseptin-S11 (DS11; Frogs, amphibians, animals)

    • Source

    • Phyllomedusa sauvagei (Sauvage's leaf frog)

    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)

    • Gene

    • Not found

    • Sequence

    • ALWKTLLKGAGKVFGHVAKQFLGSQGQPES

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01683 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01683.

Physicochemical Information

    • Formula

    • C147H232N40O39

    • Absent Amino Acids

    • CDIMNRY

    • Common Amino Acids

    • G

    • Mass

    • 3183.7

    • PI

    • 10

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +4

    • Boman Index

    • -13.48

    • Hydrophobicity

    • -0.167

    • Aliphatic Index

    • 81.33

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 189.66

    • Polar Residues

    • 8

DRAMP01683

DRAMP01683 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Dermaseptin S9, an alpha-helical antimicrobial peptide with a hydrophobic core and cationic termini.

    • Reference

    • Biochemistry. 2006 Jan 17;45(2):468-480.

    • Author

    • Lequin O, Ladram A, Chabbert L, Bruston F, Convert O, Vanhoye D, Chassaing G, Nicolas P, Amiche M.