General Information

    • DRAMP ID

    • DRAMP01710

    • Peptide Name

    • Dermaseptin DS VIII-like peptide (Frogs, amphibians, animals)

    • Source

    • Phyllomedusa burmeisteri (Brazilian common walking leaf frog)

    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)

    • Gene

    • Not found

    • Sequence

    • ALWKTMLKKLGTVALHAGKAALGAAADTISQGA

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01710 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01710.

Physicochemical Information

    • Formula

    • C146H247N41O41S

    • Absent Amino Acids

    • CEFNPRY

    • Common Amino Acids

    • A

    • Mass

    • 3264.88

    • PI

    • 10

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +4

    • Boman Index

    • 6.06

    • Hydrophobicity

    • 0.442

    • Aliphatic Index

    • 106.97

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 171.88

    • Polar Residues

    • 8

DRAMP01710

DRAMP01710 chydropathy plot

Comments Information

    • MOA

    • Probably acts by disturbing membrane functions with its amphipathic structure (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Identification of peptides from Phyllomedusa burmesteri skin secretomics by nano LC MS/MS.

    • Reference

    • Submitted (APR-2009) to UniProtKB

    • Author

    • Conceicao K, Klitzke C.F, Brito R.C, Andrade D.F, Junca F.A, Biondi I, Lopes-Ferreira M.