General Information

    • DRAMP ID

    • DRAMP01719

    • Peptide Name

    • Dermatoxin-J2 (DRT-J2; Frogs, amphibians, animals)

    • Source

    • Phasmahyla jandaia (Jandaia leaf frog)

    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)

    • Gene

    • Not found

    • Sequence

    • SLGGFLKGVGKALAGVGKMVADQFGNLLQAGQ

    • Sequence Length

    • 32

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01719 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01719.

Physicochemical Information

    • Formula

    • C140H231N39O40S

    • Absent Amino Acids

    • CEHIPRTWY

    • Common Amino Acids

    • G

    • Mass

    • 3132.67

    • PI

    • 9.7

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +2

    • Boman Index

    • 7.76

    • Hydrophobicity

    • 0.409

    • Aliphatic Index

    • 100.63

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 10

DRAMP01719

DRAMP01719 chydropathy plot

Comments Information

    • Function

    • Antimicrobial peptide.

    • Tissue specificity

    • Expressed by the skin glands.

    • PTM

    • C-terminal amidation.

Literature Information

  • ·Literature 1

    • Title

    • Peptidomic dissection of the skin secretion of Phasmahyla jandaia (Bokermann and Sazima, 1978) (Anura, Hylidae, Phyllomedusinae).

    • Reference

    • Toxicon. 2011 Jan;57(1):35-52.

    • Author

    • Rates B, Silva LP, Ireno IC, Leite FS, Borges MH, Bloch C Jr, De Lima ME, Pimenta AM.