• DRAMP ID

    • DRAMP01861
    • Peptide Name

    • Brevinin-2RTb antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Amolops ricketti (Chinese sucker frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTSKKSLLVLFFLGTISLSFCEEERNADEDDGEMTEEVKRGILDTLKEFGKTAAKGIAQSLLSTASCKLAKTC
    • Sequence Length

    • 74
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01861 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01861.
    • Formula

    • C354H580N90O115S5
    • Absent Amino Acids

    • HPWY
    • Common Amino Acids

    • L
    • Mass

    • 8097.33
    • PI

    • 5.05
    • Basic Residues

    • 10
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 26
    • Net Charge

    • -2
    • Boman Index

    • -106.53
    • Hydrophobicity

    • -0.077
    • Aliphatic Index

    • 84.46
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 1.71
    • Polar Residues

    • 23

DRAMP01861

DRAMP01861 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • ntification and characterization of antimicrobial peptides from skin of Amolops ricketti (Anura: Ranidae).
    • Reference

    • Peptides. 2012 Jan;33(1):27-34.
    • Author

    • Wang H, Ran R, Yu H, Yu Z, Hu Y, Zheng H, Wang D, Yang F, Liu R, Liu J.