General Information

    • DRAMP ID

    • DRAMP01862

    • Peptide Name

    • Brevinin-1RTb antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Amolops ricketti (Chinese sucker frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTSKKSMLLLFFLGTINLSLCEQERNADEEERRDDEDKRDVEVEKRFLGSLLGLVGKVVPTLFCKISKKC

    • Sequence Length

    • 71

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01862 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01862.

Physicochemical Information

    • Formula

    • C361H595N97O109S5

    • Absent Amino Acids

    • HWY

    • Common Amino Acids

    • L

    • Mass

    • 8198.58

    • PI

    • 6.25

    • Basic Residues

    • 13

    • Acidic Residues

    • 13

    • Hydrophobic Residues

    • 24

    • Net Charge

    • 0

    • Boman Index

    • -147.44

    • Hydrophobicity

    • -0.283

    • Aliphatic Index

    • 93.24

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.79

    • Polar Residues

    • 17

DRAMP01862

DRAMP01862 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • ntification and characterization of antimicrobial peptides from skin of Amolops ricketti (Anura: Ranidae).

    • Reference

    • Peptides. 2012 Jan;33(1):27-34.

    • Author

    • Wang H, Ran R, Yu H, Yu Z, Hu Y, Zheng H, Wang D, Yang F, Liu R, Liu J.