General Information

    • DRAMP ID

    • DRAMP01876

    • Peptide Name

    • Brevinin-2PRb (Frogs, amphibians, animals)

    • Source

    • Rana pirica (Hokkaido frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLMSLFRGGVLKTAGKHIFKNVGGSLLDQAKCKITGEC

    • Sequence Length

    • 38

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • [Ref.15003829] Gram-negative bacterium: Escherichia coli(MIC=3μM), Pseudemonas aeruginosa(MIC=3μM), Enterobacter cloacae(MIC=6μM), Klebsiella pneumoniae(MIC=6μM);
      • Gram-positive bacterium: Staphylococcus aureus(MIC=25μM);
      • Yeast: Candida albicans(MIC>100μM)

    • Hemolytic Activity

      • [Ref.15003829] HC50=65 μM against human erythrocytes

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys31 and Cys37)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01876 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01876.

Physicochemical Information

    • Formula

    • C175H294N50O49S3

    • Absent Amino Acids

    • PWY

    • Common Amino Acids

    • G

    • Mass

    • 3978.74

    • PI

    • 9.59

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +5

    • Boman Index

    • -23.39

    • Hydrophobicity

    • 0.145

    • Aliphatic Index

    • 92.37

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 3.38

    • Polar Residues

    • 14

DRAMP01876

DRAMP01876 chydropathy plot

Comments Information

    • Function

    • activity against reference strains of Gram-negative (Escherichia coli, Pseudomonas aeruginosa, Enterobacter cloacae, Klebsiella pneumoniae) and Gram-positive (Staphlococcus aureus) bacteria but displayed relatively low hemolytic activity.

Literature Information

  • ·Literature 1

    • Title

    • A family of brevinin-2 peptides with potent activity against Pseudomonas aeruginosa from the skin of the Hokkaido frog, Rana pirica.

    • Reference

    • Regul Pept. 2004 May 15;118(3):135-141.

    • Author

    • Conlon JM, Sonnevend A, Patel M, Al-Dhaheri K, Nielsen PF, Kolodziejek J, Nowotny N, Iwamuro S, P