• DRAMP ID

    • DRAMP01877
    • Peptide Name

    • Brevinin-2PRd (Frogs, amphibians, animals)
    • Source

    • Rana pirica (Hokkaido frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GLMSVLKGVLKTAGKHIFKNVGGSLLDQAKCKITGQC
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.15003829] Gram-negative bacterium: Escherichia coli(MIC=3μM), Pseudemonas aeruginosa(MIC=3μM), Enterobacter cloacae(MIC=6μM), Klebsiella pneumoniae(MIC=6μM);
      • Gram-positive bacterium: Staphylococcus aureus(MIC=25μM);
      • Yeast: Candida albicans(MIC=100μM)
    • Hemolytic Activity

      • [Ref.15003829] HC50=100 μM against human erythrocytes
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization (Cys31 and Cys37)
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys31 and Cys37.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01877 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01877.
    • Formula

    • C169H292N48O47S3
    • Absent Amino Acids

    • EPRWY
    • Common Amino Acids

    • GK
    • Mass

    • 3844.65
    • PI

    • 9.79
    • Basic Residues

    • 7
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +6
    • Boman Index

    • -12.63
    • Hydrophobicity

    • 0.214
    • Aliphatic Index

    • 102.7
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 3.47
    • Polar Residues

    • 13

DRAMP01877

DRAMP01877 chydropathy plot
    • Function

    • activity against reference strains of Gram-negative (Escherichia coli, Pseudomonas aeruginosa, Enterobacter cloacae, Klebsiella pneumoniae) and Gram-positive (Staphlococcus aureus) bacteria but displayed relatively low hemolytic activity.
  • ·Literature 1
    • Title

    • A family of brevinin-2 peptides with potent activity against Pseudomonas aeruginosa from the skin of the Hokkaido frog, Rana pirica.
    • Reference

    • Regul Pept. 2004 May 15;118(3):135-141.
    • Author

    • Conlon JM, Sonnevend A, Patel M, Al-Dhaheri K, Nielsen PF, Kolodziejek J, Nowotny N, Iwamuro S, P