General Information

    • DRAMP ID

    • DRAMP01879

    • Peptide Name

    • Brevinin-2LTa (Frogs, amphibians, animals)

    • Source

    • Hylarana latouchii (Broad-folded frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GAFGDLLKGVAKEAGMKLLNMAQCKLSGKC

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus ATCC2592 (MIC=2 µM), Bacillus licheniformis X39 (MIC=8 µM), Staphylococcus carnosus KHS (MIC=2 µM), Rhodococcus rhodochrous X15 (MIC=0.5 µM);
      • Gram-negative bacteria: Escherichia coli ATCC25922 (MIC=32.5 µM), Serratia rubidaea X01 (MIC=130 µM), Pseudomonas aeruginosa 1.50 (MIC=65 µM), Psychrobacter faecalis X29 (MIC=0.5 µM).

    • Hemolytic Activity

      • [Ref.22426384] LD50=520 μM against human erythrocytes

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys24 and Cys30)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys24 and Cys30.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01879 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01879.

Physicochemical Information

    • Formula

    • C133H229N37O38S4

    • Absent Amino Acids

    • HIPRTWY

    • Common Amino Acids

    • GKL

    • Mass

    • 3082.75

    • PI

    • 9.24

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +3

    • Boman Index

    • -8.04

    • Hydrophobicity

    • 0.19

    • Aliphatic Index

    • 88

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 4.31

    • Polar Residues

    • 9

DRAMP01879

DRAMP01879 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and characterization of antimicrobial peptides from skin of the broad-folded frog, Hylarana latouchii.

    • Reference

    • Biochimie. 2012 Jun;94(6):1317-1326.

    • Author

    • Wang H, Yu Z, Hu Y, Yu H, Ran R, Xia J, Wang D, Yang S, Yang X, Liu J.