General Information

    • DRAMP ID

    • DRAMP01883

    • Peptide Name

    • Salivary gland antimicrobial peptide 1

    • Source

    • Bradysia hygida

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MRMSIKCFAVIFVAFAFFLGQISRAEACIPDGGRCHESDPGPGCCSGFCYRERNWKDGDCRKRP

    • Sequence Length

    • 64

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01883 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01883.

Physicochemical Information

    • Formula

    • C312H477N93O86S9

    • Absent Amino Acids

    • T

    • Common Amino Acids

    • CGRF

    • Mass

    • 7195.33

    • PI

    • 8.57

    • Basic Residues

    • 11

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +4

    • Boman Index

    • -124.8

    • Hydrophobicity

    • -0.238

    • Aliphatic Index

    • 47.34

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 116.9

    • Polar Residues

    • 20

DRAMP01883

DRAMP01883 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • The innate immune system of larvae and pupae of Bradysia hygida (Diptera, Sciaridae) is provided with an additional external preventive mechanism of defense, which is regulated in development.

    • Reference

    • Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases

    • Author

    • da Silva JAC, Zanarotti GM, Gallina AP, de Almeida JC.
  • ·Literature 2

    • Title

    • Reference

    • Author