• DRAMP ID

    • DRAMP01883
    • Peptide Name

    • Salivary gland antimicrobial peptide 1
    • Source

    • Bradysia hygida
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MRMSIKCFAVIFVAFAFFLGQISRAEACIPDGGRCHESDPGPGCCSGFCYRERNWKDGDCRKRP
    • Sequence Length

    • 64
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01883 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01883.
    • Formula

    • C312H477N93O86S9
    • Absent Amino Acids

    • T
    • Common Amino Acids

    • CGRF
    • Mass

    • 7195.33
    • PI

    • 8.57
    • Basic Residues

    • 11
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 19
    • Net Charge

    • +4
    • Boman Index

    • -124.8
    • Hydrophobicity

    • -0.238
    • Aliphatic Index

    • 47.34
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 116.9
    • Polar Residues

    • 20

DRAMP01883

DRAMP01883 chydropathy plot
    • Function

    • Amphibian defense peptide.
  • ·Literature 1
    • Title

    • The innate immune system of larvae and pupae of Bradysia hygida (Diptera, Sciaridae) is provided with an additional external preventive mechanism of defense, which is regulated in development.
    • Reference

    • Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases
    • Author

    • da Silva JAC, Zanarotti GM, Gallina AP, de Almeida JC.
  • ·Literature 2
    • Title

    • Reference

    • Author