General Information

    • DRAMP ID

    • DRAMP01884

    • Peptide Name

    • Nigroain-F antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Rana nigrovittata (Black-striped frog) (Hylarana nigrovittata)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTMKKSLLLLFFLGMISLSLCQDERGADEDDGGEMTEEEKRGAFGNFLKGVAKKAGLKILSIAQCKLSGTC

    • Sequence Length

    • 72

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01884 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01884.

Physicochemical Information

    • Formula

    • C343H563N89O104S7

    • Absent Amino Acids

    • HPWY

    • Common Amino Acids

    • L

    • Mass

    • 7822.2

    • PI

    • 6.19

    • Basic Residues

    • 10

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 25

    • Net Charge

    • 0

    • Boman Index

    • -73.84

    • Hydrophobicity

    • 0.031

    • Aliphatic Index

    • 86.81

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.76

    • Polar Residues

    • 21

DRAMP01884

DRAMP01884 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • Peptidomics and genomics analysis of novel antimicrobial peptides from the frog, Rana nigrovittata.

    • Reference

    • Genomics. 2010,95:66-71.

    • Author

    • Ma Y., Liu C., Liu X., Wu J., Yang H., Wang Y., Li J., Yu H., Lai R.
  • ·Literature 2

    • Title

    • Reference

    • Author