General Information

    • DRAMP ID

    • DRAMP01909

    • Peptide Name

    • Brevinin-2GHa (AMP-1; Frogs, amphibians, animals)

    • Source

    • Rana guentheri (Gunther's frog)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • GFSSLFKAGAKYLLKSVGKAGAQQLACKAANNCA

    • Sequence Length

    • 34

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus FDA209P (MIC=14.9 µg/ml), Bacillus subtilis ATCC 6633 (MIC>64 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys27 and Cys33.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01909 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01909.

Physicochemical Information

    • Formula

    • C151H247N43O43S2

    • Absent Amino Acids

    • DEHIMPRTW

    • Common Amino Acids

    • A

    • Mass

    • 3417

    • PI

    • 9.79

    • Basic Residues

    • 5

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +5

    • Boman Index

    • -11.97

    • Hydrophobicity

    • 0.165

    • Aliphatic Index

    • 77.94

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 48.94

    • Polar Residues

    • 12

DRAMP01909

DRAMP01909 chydropathy plot

Comments Information

    • Function

    • Antimicrobial peptide.

    • Tissue specificity

    • Expressed by the skin glands.

    • PTM

    • Problely contains one disulfide bond 27-33.

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of novel antimicrobial peptides from the skin secretion of Hylarana guentheri.

    • Reference

    • Peptides. 2006 Dec;27(12):3077-3084.

    • Author

    • Zhou J, McClean S, Thompson A, Zhang Y, Shaw C, Rao P, Bjourson AJ.