• • DRAMP ID

  • DRAMP01911

• • Peptide Name

  • Brevinin-2GHc (AMP-4; Frogs, amphibians, animals)

• • Source

  • Rana guentheri (Gunther's frog)

• • Family

  • Belongs to the frog skin active peptide family (Brevinin subfamily)

• • Gene

  • br2GHc

• • Sequence

  • SIWEGIKNAGKGFLVSILDKVRCKVAGGCNP

• • Sequence Length

  • 31

• • UniProt Entry

  • A0AEI6

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-positive bacteria: Staphylococcus aureus FDA209P (MIC=9.8 µg/ml), Bacillus subtilis ATCC 6633 (MIC>64 µg/ml);
    • Gram-negative bacteria: Escherichia coli O111 (MIC=19.6 µg/ml), Escherichia coli ATCC 25922 (MIC=9.8 µg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bond between Cys24 and Cys30.

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP01911.

DRAMP01911

• • Function

  • Antimicrobial peptide.

• • Tissue specificity

  • Expressed by the skin glands.

• • PTM

  • Problely contains one disulfide bond 24-30.

• ·Literature 1

• • Title

  • Purification and characterization of novel antimicrobial peptides from the skin secretion of Hylarana guentheri.

• • Pubmed ID

  • 16979798

• • Reference

  • Peptides. 2006 Dec;27(12):3077-3084.

• • Author

  • Zhou J, McClean S, Thompson A, Zhang Y, Shaw C, Rao P, Bjourson AJ.