General Information

    • DRAMP ID

    • DRAMP02033

    • Peptide Name

    • Brevinin-2TSa (Frogs, amphibians, animals)

    • Source

    • Rana tsushimensis (Tsushima brown frog)

    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)

    • Gene

    • Not found

    • Sequence

    • GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC

    • Sequence Length

    • 33

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • [Ref.16413829]Gram-negative bacteria: Escherichia coli ATCC 25922 (MIC=3 µM), Klebsiella pneumoniae KK3 9904 (MIC=6 µM), Enterobacter cloacae HNTCC 53001 (MIC=6 µM), Pseudomonas aeruginosa ATCC 27853 (MIC=6 µM), Proteus mirabilis ATCC 25933 (MIC>100 µM);
      • Gram-positive bacteria: Staphylococcus aureus NCTC 8325 (MIC=12.5 µM), Methicillin-resistant Staphylococcus aureus T7/20 (MIC=25 µM), Staphylococcus epidermidis RP62A (MIC=12.5 µM), Enterococcus faecalis ATCC 29212 (MIC=25 µM);
      • Yeast: Candida albicans ATCC 90028 (MIC=100 µM).

    • Hemolytic Activity

      • [Ref.16413829] LD50=100 μM against human erythrocytes

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys27 and Cys33)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys27 and Cys33.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02033 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C148H255N41O41S3

    • Absent Amino Acids

    • ENPRWY

    • Common Amino Acids

    • G

    • Mass

    • 3361.08

    • PI

    • 9.6

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • 0.18

    • Hydrophobicity

    • 0.455

    • Aliphatic Index

    • 103.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 3.91

    • Polar Residues

    • 12

DRAMP02033

DRAMP02033 chydropathy plot

Comments Information

    • Function

    • Activity against a range of Gram-positive and Gram-negative bacteria, but relatively low hemolytic activity against human erythrocytes.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis.

    • Reference

    • Comp Biochem Physiol C Toxicol Pharmacol. 2006 May;143(1):42-49.

    • Author

    • Conlon JM, Al-Ghaferi N, Abraham B, Sonnevend A, Coquet L, Leprince J, Jouenne T, Vaudry H, Iwamuro S.