General Information

    • DRAMP ID

    • DRAMP02205

    • Peptide Name

    • Ranatuerin-2YJ (Frogs, amphibians, animals)

    • Source

    • Rana dybowskii (Dybovsky's frog) (Korean brown frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTLKKSMLLLFFLGTISLSLCQDEGADEDHGGEMTTEEKRGLMDIFKVAVNKLLAAGMNKPRCKAAHC

    • Sequence Length

    • 69

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02205 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02205.

Physicochemical Information

    • Formula

    • C332H543N89O98S8

    • Absent Amino Acids

    • WY

    • Common Amino Acids

    • L

    • Mass

    • 7605.98

    • PI

    • 6.7

    • Basic Residues

    • 11

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +2

    • Boman Index

    • -75.11

    • Hydrophobicity

    • 0.007

    • Aliphatic Index

    • 84.93

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.84

    • Polar Residues

    • 18

DRAMP02205

DRAMP02205 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Induction of antimicrobial peptides from Rana dybowskii under Rana grylio virus stress, and bioactivity analysis.

    • Reference

    • Can J Microbiol. 2012 Jul;58(7):848-855.

    • Author

    • Yang SJ, Xiao XH, Xu YG, Li DD, Chai LH, Zhang JY.