General Information

    • DRAMP ID

    • DRAMP02210

    • Peptide Name

    • Ranatuerin-2AMa protein (Frogs, amphibians, animals)

    • Source

    • Rana amurensis (Korean brown frog)

    • Family

    • Not found

    • Gene

    • ranatuerin-2AMa

    • Sequence

    • MFTSKKSMLLLFFLGTISLSLCEEERDEDEVIEEEVKRGLLSVFKGVLKGVGKNVAGSLLDQLKCKISGGC

    • Sequence Length

    • 71

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02210 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02210.

Physicochemical Information

    • Formula

    • C344H573N87O105S5

    • Absent Amino Acids

    • HPWY

    • Common Amino Acids

    • L

    • Mass

    • 7768.15

    • PI

    • 5.36

    • Basic Residues

    • 10

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 26

    • Net Charge

    • -1

    • Boman Index

    • -68.17

    • Hydrophobicity

    • 0.179

    • Aliphatic Index

    • 108.31

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.79

    • Polar Residues

    • 21

DRAMP02210

DRAMP02210 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Components of the peptidome and transcriptome persist in lin wa pi: the dried skin of the Heilongjiang brown frog (Rana amurensis) as used in traditional Chinese medicine.

    • Reference

    • Peptides. 2006 Nov;27(11):2688-2694.

    • Author

    • Zhou M, Liu Y, Chen T, Fang X, Walker B, Shaw C.