General Information

    • DRAMP ID

    • DRAMP02212

    • Peptide Name

    • Antimicrobial peptide ranatuerin-2ZHa (Frogs, amphibians, animals)

    • Source

    • Rana zhenhaiensis

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTLKKSLLLFFFLGTISLSLCEQERGADEDDGVEMTEEEVKRGLADYWRTAFRANFANLGPGIRCKSARC

    • Sequence Length

    • 71

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02212 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02212.

Physicochemical Information

    • Formula

    • C356H559N97O106S5

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • L

    • Mass

    • 8054.24

    • PI

    • 5.33

    • Basic Residues

    • 10

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 26

    • Net Charge

    • -1

    • Boman Index

    • -129.66

    • Hydrophobicity

    • -0.187

    • Aliphatic Index

    • 77.04

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 101.64

    • Polar Residues

    • 20

DRAMP02212

DRAMP02212 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and functional characterization of novel antimicrobial peptides from the skin of brown frog, Rana zhenhaiensis.

    • Reference

    • Zoolog Sci. 2012 Sep;29(9):553-558.

    • Author

    • Xu B, Che H, Kang L, Zheng S, Mu S, Wan F.