General Information

    • DRAMP ID

    • DRAMP02267

    • Peptide Name

    • Antimicrobial amphipathic helix-forming peptide (Frogs, amphibians, animals)

    • Source

    • Xenopus laevis (African clawed frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LKCVNLQANGIKMTQECAKEDTKCLTLRSLKKTLKFCASGRTCTTMKIMSLPGEQITCCEGNMCNA

    • Sequence Length

    • 66

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02267 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02267.

Physicochemical Information

    • Formula

    • C299H517N87O95S12

    • Absent Amino Acids

    • HWY

    • Common Amino Acids

    • CKTL

    • Mass

    • 7235.64

    • PI

    • 8.88

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +5

    • Boman Index

    • -97.28

    • Hydrophobicity

    • -0.174

    • Aliphatic Index

    • 69.55

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 7.69

    • Polar Residues

    • 27

DRAMP02267

DRAMP02267 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification of antimicrobial peptides from an extract of the skin of Xenopus laevis using heparin-affinity HPLC: characterization by ion-spray mass spectrometry.

    • Reference

    • Anal Biochem. 1994 Feb 15;217(1):84-90.

    • Author

    • James S, Gibbs BF, Toney K, Bennett HP.