General Information

    • DRAMP ID

    • DRAMP02310

    • Peptide Name

    • HbbetaP-1 (fish, chordates, animals)

    • Source

    • Ictalurus punctatus (Catfish)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • AANFGPSVFTPEVHETWQKFLNVVVAALGKQYH

    • Sequence Length

    • 33

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiparasitic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02310 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02310.

Physicochemical Information

    • Formula

    • C173H254N44O46

    • Absent Amino Acids

    • CDIMR

    • Common Amino Acids

    • V

    • Mass

    • 3686.19

    • PI

    • 6.96

    • Basic Residues

    • 4

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +2

    • Boman Index

    • -16.65

    • Hydrophobicity

    • 0.018

    • Aliphatic Index

    • 79.7

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 218.44

    • Polar Residues

    • 8

DRAMP02310

DRAMP02310 chydropathy plot

Comments Information

    • Function

    • Showes moderate activity against Gram-negative bacteria, Aeromonas hydrophila and Vibrio alginolyticus, but no activity against Gram-positive bacteria such as S. aureus, Streptococcus faecalis S. iniae.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptides derived from hemoglobin are expressed in epithelium of channel catfish (Ictalurus punctatus, Rafinesque).

    • Reference

    • Dev Comp Immunol. 2008;32(11):1301-1312.

    • Author

    • Ullal AJ, Litaker RW, Noga EJ.