General Information

    • DRAMP ID

    • DRAMP02312

    • Peptide Name

    • Hipposin (fish, chordates, animals)

    • Source

    • Hippoglossus hippoglossus (Atlantic halibut)

    • Family

    • Belongs to the histone H2A family

    • Gene

    • Not found

    • Sequence

    • SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL

    • Sequence Length

    • 51

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Gram+ (MIC=0.3 µM);##Gram- (MIC=0.3 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02312 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02312.

Physicochemical Information

    • Formula

    • C236H398N86O61

    • Absent Amino Acids

    • CDEIMW

    • Common Amino Acids

    • GR

    • Mass

    • 5416.3

    • PI

    • 12.23

    • Basic Residues

    • 15

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +15

    • Boman Index

    • -124.28

    • Hydrophobicity

    • -0.68

    • Aliphatic Index

    • 67.06

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 59.6

    • Polar Residues

    • 17

DRAMP02312

DRAMP02312 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Hipposin, a histone-derived antimicrobial peptide in Atlantic halibut (Hippoglossus hippoglossus L.).

    • Reference

    • Biochim Biophys Acta. 2003 Mar 21;1646(1-2):207-215.

    • Author

    • Birkemo GA, Luders T, Andersen O, Nes IF, Nissen-Meyer J