General Information

    • DRAMP ID

    • DRAMP02333

    • Peptide Name

    • Piscidin-4 (Pis-4; fish, chordates, animals)

    • Source

    • Morone chrysops x Morone saxatilis (white bass x striped sea-bass)

    • Family

    • Belongs to the pleurocidin family

    • Gene

    • Not found

    • Sequence

    • FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP

    • Sequence Length

    • 44

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02333 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02333.

Physicochemical Information

    • Formula

    • C235H360N80O63

    • Absent Amino Acids

    • CM

    • Common Amino Acids

    • R

    • Mass

    • 5313.94

    • PI

    • 11.23

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +7

    • Boman Index

    • -168.49

    • Hydrophobicity

    • -1.227

    • Aliphatic Index

    • 46.59

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 162.56

    • Polar Residues

    • 9

DRAMP02333

DRAMP02333 chydropathy plot

Comments Information

    • Function

    • Piscidin 4 demonstrates potent, broad-spectrum, antibacterial activity against a number of fish and human pathogens, including multi-drug resistant bacteria.

    • Sequence similarity

    • It has considerable (to >65%) N-terminal sequence homology to piscidins 1-3.

Literature Information

  • ·Literature 1

    • Title

    • Piscidin 4, a novel member of the piscidin family of antimicrobial peptides.

    • Reference

    • Comp Biochem Physiol B Biochem Mol Biol. 2009 Apr;152(4):299-305.

    • Author

    • Noga EJ, Silphaduang U, Park NG, Seo JK, Stephenson J, Kozlowicz S.