General Information

    • DRAMP ID

    • DRAMP02338

    • Peptide Name

    • Beta-defensin 1 (fish, chordates, animals)

    • Source

    • Oncorhynchus mykiss (Rainbow trout)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MVTLVLLVFLLLNVVEDEAASFPFSCPTLSGVCRKLCLPTEMFFGPLGCGKGFLCCVSHF

    • Sequence Length

    • 60

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02338 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02338.

Physicochemical Information

    • Formula

    • C299H466N68O77S8

    • Absent Amino Acids

    • IQWY

    • Common Amino Acids

    • L

    • Mass

    • 6501.88

    • PI

    • 5.51

    • Basic Residues

    • 4

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 27

    • Net Charge

    • 0

    • Boman Index

    • 36.18

    • Hydrophobicity

    • 1.108

    • Aliphatic Index

    • 108.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 6.36

    • Polar Residues

    • 19

DRAMP02338

DRAMP02338 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Expression and antiviral activity of a beta-defensin-like peptide identified in the rainbow trout (Oncorhynchus mykiss) EST sequences.

    • Reference

    • Submitted (JUN-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • Falco A, Chico V, Marroqui L, Perez L, Coll J.M, Estepa A.