General Information

    • DRAMP ID

    • DRAMP02345

    • Peptide Name

    • Liver-expressed antimicrobial peptide 2A (LEAP-2A; fish, chordates, animals)

    • Source

    • Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

    • Family

    • Not found

    • Gene

    • LEAP-2A

    • Sequence

    • PEGQRALKRMARMTPLWRTMGTKPYGAYCLNNYECSTGICRGGHCMFSQPIKS

    • Sequence Length

    • 53

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02345 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02345.

Physicochemical Information

    • Formula

    • C257H408N78O72S8

    • Absent Amino Acids

    • DV

    • Common Amino Acids

    • GR

    • Mass

    • 5999.03

    • PI

    • 9.63

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +7

    • Boman Index

    • -99.29

    • Hydrophobicity

    • -0.585

    • Aliphatic Index

    • 42.45

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 10220

    • Absorbance 280nm

    • 196.54

    • Polar Residues

    • 22

DRAMP02345

DRAMP02345 chydropathy plot

Comments Information

    • LEAP-2 is a blood-derived peptide expressed predominantly in the liver.

Literature Information

  • ·Literature 1

    • Title

    • Discovery and characterization of two types of liver-expressed antimicrobial peptide 2 (LEAP-2) genes in rainbow trout.

    • Reference

    • Vet Immunol Immunopathol. 2004 Oct;101(3-4):259-269.

    • Author

    • Zhang YA, Zou J, Chang CI, Secombes CJ.