General Information

    • DRAMP ID

    • DRAMP02346

    • Peptide Name

    • Liver-expressed antimicrobial peptide 2B

    • Source

    • Oncorhynchus mykiss (rainbow trout)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GVCLVALILMHQVCASPIGSHDSRLSLQQGTKLLERRTRMTPLWRFMGTKPTGAYCRDHFECSTQICRRGHCALSGA

    • Sequence Length

    • 77

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02346 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02346.

Physicochemical Information

    • Formula

    • C366H598N116O103S9

    • Absent Amino Acids

    • N

    • Common Amino Acids

    • LR

    • Mass

    • 8560.03

    • PI

    • 9.43

    • Basic Residues

    • 14

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +10

    • Boman Index

    • -128.47

    • Hydrophobicity

    • -0.101

    • Aliphatic Index

    • 78.57

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 96.91

    • Polar Residues

    • 26

DRAMP02346

DRAMP02346 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Not found

    • Reference

    • Not found

    • Author

    • Not found