General Information

    • DRAMP ID

    • DRAMP02369

    • Peptide Name

    • Liver-expressed antimicrobial peptide 2 (fish, chordates, animals)

    • Source

    • Ctenopharyngodon idella (Grass carp) (Leuciscus idella)

    • Family

    • Not found

    • Gene

    • LEAP-2

    • Sequence

    • LLAWCLVFLVIVQQVTSSPVPQSDTPLTSVQEVQRSLKRTARMTPLWRIMGTKPHGAYCQNHYECSTGICRKGHCSYS

    • Sequence Length

    • 78

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli XC-1 and Aeromonas hydrophila S2.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02369 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02369.

Physicochemical Information

    • Formula

    • C386H615N111O110S7

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • SLTV

    • Mass

    • 8795.23

    • PI

    • 9.23

    • Basic Residues

    • 11

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +8

    • Boman Index

    • -107.65

    • Hydrophobicity

    • -0.146

    • Aliphatic Index

    • 79.87

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 15720

    • Absorbance 280nm

    • 204.16

    • Polar Residues

    • 28

DRAMP02369

DRAMP02369 chydropathy plot

Comments Information

    • Grass carp LEAP-2 gene is expressed in a wide range of tissues except blood, with the highest level of transcripts found in liver.

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and expression analysis of the liver-expressed antimicrobial peptide 2 (LEAP-2) gene in grass carp.

    • Reference

    • Vet Immunol Immunopathol. 2010 Feb 15;133(2-4):133-143.

    • Author

    • Liu F, Li JL, Yue GH, Fu JJ, Zhou ZF.