General Information

    • DRAMP ID

    • DRAMP02383

    • Peptide Name

    • saBD (seabream beta defensin; fish, chordates, animals)

    • Source

    • Sparus aurata (Teleost fish gilthead seabream)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ASFPWSCPSLSGVCRKVCLPTELFFGPLGCGKGFLCGVSHFL

    • Sequence Length

    • 42

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Vibrio anguillarum (a seabream pathogenic bacterium), Bacillus subtilis (strong activity); Vibrio harvey and Photobacterium damselae (little activity).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02383 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02383.

Physicochemical Information

    • Formula

    • C205H308N50O51S5

    • Absent Amino Acids

    • DIMNQY

    • Common Amino Acids

    • GL

    • Mass

    • 4449.31

    • PI

    • 8.44

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +3

    • Boman Index

    • 15.66

    • Hydrophobicity

    • 0.721

    • Aliphatic Index

    • 78.81

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5750

    • Absorbance 280nm

    • 140.24

    • Polar Residues

    • 17

DRAMP02383

DRAMP02383 chydropathy plot

Comments Information

    • Its gene is constitutively expressed and upregulated by CpG ODNs. It is also chemotactic activity to leukocytes.

Literature Information

  • ·Literature 1

    • Title

    • Molecular and functional characterization of the gilthead seabream ?-defensin demonstrate its chemotactic and antimicrobial activity.

    • Reference

    • Mol Immunol. 2011 Jul;48(12-13):1432-1438.

    • Author

    • Cuesta A, Meseguer J, Esteban MÃ.