• DRAMP ID

    • DRAMP02391
    • Peptide Name

    • Hematopoietic antimicrobial peptide-37 (MgCath37; hagfishes, chordates, animals)
    • Source

    • Myxine glutinosa (Atlantic hagfish)
    • Family

    • Not found
    • Gene

    • CATH37
    • Sequence

    • GWFKKAWRKVKHAGRRVLDTAKGVGRHYLNNWLNRYRG
    • Sequence Length

    • 38
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-positive bacteria: Propionibacterium acnes ATCC 11827 and 33179 (MIC=2 µg/ml), Staphylococcus epidermidi (MIC=2-4 µg/ml), Streptococcus pyogenes (MIC=4 µg/ml), Enterococcus faecium (MIC=4-8 µg/ml), Staphylococcus aureus ATCC 29213 (MIC=8 µg/ml), Clostridium perfringens ATCC 9081 and 13124 (MIC=4-32 µg/ml), Enterococcus faecalis (MIC=32 µg/ml);
      • Gram-negative bacteria: Bacteroides spp. ATCC 29771, 43935, 12290 (MIC=0.5-4 µg/ml), Shigella sonnei (MIC=2-4 µg/ml), Xanthomonas maltophilia (MIC=2-8 µg/ml), Salmonella Group B (MIC=4-8 µg/ml), Pseudomonas aeruginosa ATCC 27853 (MIC=8 µg/ml), Acinetobacter baumannii (MIC=8-16 µg/ml), Escherichia coli ATCC 25922 (MIC=8 µg/ml), Enterobacter aerogenes (MIC=8-16 µg/ml), Enterobacter cloacae (MIC=8-16 µg/ml), Klebsiella pneumoniae (MIC=8-16 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02391 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02391.
    • Formula

    • C210H325N71O47
    • Absent Amino Acids

    • CEIMPQS
    • Common Amino Acids

    • R
    • Mass

    • 4596.34
    • PI

    • 11.74
    • Basic Residues

    • 13
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +12
    • Boman Index

    • -111.1
    • Hydrophobicity

    • -1.124
    • Aliphatic Index

    • 61.58
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 19480
    • Absorbance 280nm

    • 526.49
    • Polar Residues

    • 11

DRAMP02391

DRAMP02391 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Hagfish intestinal antimicrobial peptides are ancient cathelicidins.
    • Reference

    • Peptides. 2003 Nov;24(11):1655-1667.
    • Author

    • Uzzell T, Stolzenberg ED, Shinnar AE, Zasloff M.