General Information

    • DRAMP ID

    • DRAMP02392

    • Peptide Name

    • Hematopoietic antimicrobial peptide-29 (MgCath29; hagfishes, chordates, animals)

    • Source

    • Myxine glutinosa (Atlantic hagfish)

    • Family

    • Not found

    • Gene

    • CATH29

    • Sequence

    • GWFKKAWRKVKNAGRVLKGVGIHYGVGLIG

    • Sequence Length

    • 30

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02392 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02392.

Physicochemical Information

    • Formula

    • C156H248N46O33

    • Absent Amino Acids

    • CDEMPQST

    • Common Amino Acids

    • G

    • Mass

    • 3295.97

    • PI

    • 11.26

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +8

    • Boman Index

    • -15.35

    • Hydrophobicity

    • -0.043

    • Aliphatic Index

    • 97.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 430.69

    • Polar Residues

    • 9

DRAMP02392

DRAMP02392 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Hagfish intestinal antimicrobial peptides are ancient cathelicidins.

    • Reference

    • Peptides. 2003 Nov;24(11):1655-1667.

    • Author

    • Uzzell T, Stolzenberg ED, Shinnar AE, Zasloff M.