• • DRAMP ID

  • DRAMP02393

• • Peptide Name

  • HFIAP-1 (HFIAP-2; hagfishes, chordates, animals)

• • Source

  • Myxine glutinosa (Atlantic hagfish)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYRZ

• • Sequence Length

  • 38

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive bacteria: Propionibacterium acnes ATCC 11827/33179 (MIC=2 µg/ml), Staphylococcus epidermidi (MIC=2-4 µg/ml), Streptococcus pyogenes (MIC=4 µg/ml), Enterococcus faecium (MIC=4-8 µg/ml), Staphylococcus aureus ATCC 29213 (MIC=8 µg/ml), Clostridium perfringens ATCC 9081/13124 (MIC=4-32 µg/ml), Enterococcus faecalis (MIC=32 µg/ml);
    • Gram-negative bacteria: Bacteroides spp. ATCC 29771/43935/12290 (MIC=0.5-4 µg/ml), Shigella sonnei (MIC=2-4 µg/ml), Xanthomonas maltophilia (MIC=2-8 µg/ml), Salmonella Group B (MIC=4-8 µg/ml), Pseudomonas aeruginosa ATCC 27853 (MIC=8 µg/ml), Acinetobacter baumannii (MIC=8-16 µg/ml), Escherichia coli ATCC 25922 (MIC=8 µg/ml), Enterobacter aerogenes (MIC=8-16 µg/ml), Enterobacter cloacae (MIC=8-16 µg/ml), Klebsiella pneumoniae (MIC=8-16 µg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02393.

DRAMP02393

• • Function

  • Has antibacterial against a bank of Gram-negative and Gram-positive bacteria as well as a representative fungal species.

• • Sequence similarity

  • Sequences for HFIAP-1 and -2 are identical, but HFIAP-2 is brominated only at residue 7; they differ from MgCath37 by conservative replacements.

• ·Literature 1

• • Title

  • Hagfish intestinal antimicrobial peptides are ancient cathelicidins.

• • Pubmed ID

  • 15019197

• • Reference

  • Peptides. 2003 Nov;24(11):1655-1667.

• • Author

  • Uzzell T, Stolzenberg ED, Shinnar AE, Zasloff M.