General Information

    • DRAMP ID

    • DRAMP02394

    • Peptide Name

    • HFIAP-3 (hagfishes, chordates, animals)

    • Source

    • Myxine glutinosa (Atlantic hagfish)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GWFKKAWRKVKNAGRRVLKGVGIHYGVGLIZ

    • Sequence Length

    • 31

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Propionibacterium acnes ATCC 11827/33179 (MIC=2 µg/ml), Staphylococcus epidermidi (MIC=2-4 µg/ml), Streptococcus pyogenes (MIC=4 µg/ml), Enterococcus faecium (MIC=4-8 µg/ml), Staphylococcus aureus ATCC 29213 (MIC=8 µg/ml), Clostridium perfringens ATCC 9081/13124 (MIC=4-32 µg/ml), Enterococcus faecalis (MIC=32 µg/ml);
      • Gram-negative bacteria: Bacteroides spp. ATCC 29771/43935/12290 (MIC=0.5-4 µg/ml), Shigella sonnei (MIC=2-4 µg/ml), Xanthomonas maltophilia (MIC=2-8 µg/ml), Salmonella Group B (MIC=4-8 µg/ml), Pseudomonas aeruginosa ATCC 27853 (MIC=8 µg/ml), Acinetobacter baumannii (MIC=8-16 µg/ml), Escherichia coli ATCC 25922 (MIC=8 µg/ml), Enterobacter aerogenes (MIC=8-16 µg/ml), Enterobacter cloacae (MIC=8-16 µg/ml), Klebsiella pneumoniae (MIC=8-16 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02394 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02394.

Physicochemical Information

    • Formula

    • C160H255N49O32

    • Absent Amino Acids

    • CDEMPQST

    • Common Amino Acids

    • G

    • Mass

    • 3523.86

    • PI

    • 11.76

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +9

    • Boman Index

    • -31.21

    • Hydrophobicity

    • -0.174

    • Aliphatic Index

    • 94.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 416.33

    • Polar Residues

    • 8

DRAMP02394

DRAMP02394 chydropathy plot

Comments Information

    • Function

    • Has antibacterial against a bank of Gram-negative and Gram-positive bacteria as well as a representative fungal species. HFIAP-1 and HFIAP-3 exhibit similar inhibitory activity.

Literature Information

  • ·Literature 1

    • Title

    • Hagfish intestinal antimicrobial peptides are ancient cathelicidins.

    • Reference

    • Peptides. 2003 Nov;24(11):1655-1667.

    • Author

    • Uzzell T, Stolzenberg ED, Shinnar AE, Zasloff M.