• • DRAMP ID

  • DRAMP02410

• • Peptide Name

  • Antimicrobial peptide lumbricin-1

• • Source

  • Lumbricus rubellus (Humus earthworm)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • FSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEIPGEGGHAEPAAA

• • Sequence Length

  • 62

• • UniProt Entry

  • O96447

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • [Ref.9784609]Gram-positive bacteria: Bacillus subtilis ATCC 62037 (MIC=12 µg/ml), Staphylococcus aureus ATCC 15752 (MIC=16 µg/ml), Streptococcus mutans ATCC 25175 (MIC=30 µg/ml);
    • Gram-negative bacteria: Escherichia coli ATCC 27325 (MIC=12 µg/ml), Pseudomonas putidaATCC 17426 (MIC=16 µg/ml), Serratia sp. ATCC 21074 (MIC=16 µg/ml);
    • Fungi: Candida albicans ATCC 10231 (MIC=16 µg/ml), Cryptococcus neoformance ATCC 34881 (MIC=25 µg/ml), Saccharomyces cerevisiae ATCC 44774 (MIC=12 µg/ml).
    • NOTE: Minimal inhibitory concentrations were determined by incubating approximately 104–105 CFU/ml of cells with serial dilutions of each peptide in a 96-well microtiter plate.

• • Hemolytic Activity

  • • [Ref.9784609]0.02% hemolytic activity at 5 μg/ml, 0.06% hemolytic activity at 10 μg/ml, 0.14% hemolytic activity at 25 μg/ml, 0.19% hemolytic activity at 50 μg/ml, 0.23% hemolytic activity at 100 μg/ml against human erythrocytes

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02410.

DRAMP02410

• • Function

  • Displays antimicrobial activity and weak hemolytic activity.

• • Developmental stage

  • Adult-specific. Not detected in eggs or 1-week-old worms but abundant in 6-month-old worms.

• • Induction

  • Constitutively expressed. Not induced by bacterial infection.

• ·Literature 1

• • Title

  • Lumbricin I, a novel proline-rich antimicrobial peptide from the earthworm: purification, cDNA cloning and molecular characterization.

• • Pubmed ID

  • 9784609

• • Reference

  • Biochim Biophys Acta. 1998 Oct 22;1408(1):67-76.

• • Author

  • Cho JH, Park CB, Yoon YG, Kim SC.