General Information

    • DRAMP ID

    • DRAMP02414

    • Peptide Name

    • Ornithodoros defensin C (Ticks, Arthropods, animals)

    • Source

    • Ornithodoros moubata (Soft tick) (Argasid tick)

    • Family

    • Not found

    • Gene

    • omdef-C

    • Sequence

    • GYGCPFNQYQCHSHCSGIRGYKGGYCKGLFKQTCNCY

    • Sequence Length

    • 37

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02414 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02414.

Physicochemical Information

    • Formula

    • C181H260N52O51S6

    • Absent Amino Acids

    • ADEMVW

    • Common Amino Acids

    • G

    • Mass

    • 4172.73

    • PI

    • 8.86

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 4

    • Net Charge

    • +6

    • Boman Index

    • -50.8

    • Hydrophobicity

    • -0.66

    • Aliphatic Index

    • 21.08

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7825

    • Absorbance 280nm

    • 217.36

    • Polar Residues

    • 23

DRAMP02414

DRAMP02414 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Two isoforms of a member of the arthropod defensin family from the soft tick, Ornithodoros moubata (Acari: Argasidae).

    • Reference

    • Insect Biochem Mol Biol. 2001 Jun 22;31(8):747-751.

    • Author

    • Nakajima Y, van der Goes van Naters-Yasui A, Taylor D, Yamakawa M.