• DRAMP ID

    • DRAMP02415
    • Peptide Name

    • Ornithodoros defensin D (Ticks, Arthropods, animals)
    • Source

    • Ornithodoros moubata (Soft tick) (Argasid tick)
    • Family

    • Not found
    • Gene

    • omdef-D
    • Sequence

    • GFGCPFNQYECHAHCSGVPGYKGGYCKGLFKQTCNCY
    • Sequence Length

    • 37
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02415 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02415.
    • Formula

    • C179H252N48O50S6
    • Absent Amino Acids

    • DIMRW
    • Common Amino Acids

    • G
    • Mass

    • 4068.62
    • PI

    • 8.3
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +4
    • Boman Index

    • -29.7
    • Hydrophobicity

    • -0.408
    • Aliphatic Index

    • 21.08
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6335
    • Absorbance 280nm

    • 175.97
    • Polar Residues

    • 21

DRAMP02415

DRAMP02415 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Two isoforms of a member of the arthropod defensin family from the soft tick, Ornithodoros moubata (Acari: Argasidae).
    • Reference

    • Insect Biochem Mol Biol. 2001 Jun 22;31(8):747-751.
    • Author

    • Nakajima Y, van der Goes van Naters-Yasui A, Taylor D, Yamakawa M.