General Information

    • DRAMP ID

    • DRAMP02417

    • Peptide Name

    • Defensin (Ticks, Arthropods, animals)

    • Source

    • Ornithodoros coriaceus (Soft tick) (Argasid tick)

    • Family

    • Belongs to the invertebrate defensin family

    • Gene

    • Not found

    • Sequence

    • MVRARRGCGCPLNQGACHRHCKSIGRRGGYCAGFLKQTCTCYRN

    • Sequence Length

    • 44

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02417 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02417.

Physicochemical Information

    • Formula

    • C199H327N75O54S8

    • Absent Amino Acids

    • DEW

    • Common Amino Acids

    • CGR

    • Mass

    • 4890.74

    • PI

    • 9.89

    • Basic Residues

    • 11

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +11

    • Boman Index

    • -112.94

    • Hydrophobicity

    • -0.568

    • Aliphatic Index

    • 40

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 78.02

    • Polar Residues

    • 21

DRAMP02417

DRAMP02417 chydropathy plot

Comments Information

    • Function

    • Antibacterial peptide mostly active against Gram-positive bacteria (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • An insight into the salivary transcriptome and proteome of the soft tick and vector of epizootic bovine abortion, Ornithodoros coriaceus.

    • Reference

    • J Proteomics. 2008 Dec 2;71(5):493-512.

    • Author

    • Francischetti IM, Meng Z, Mans BJ, Gudderra N, Hall M, Veenstra TD, Pham VM, Kotsyfakis M, Ribeiro JM.