General Information

    • DRAMP ID

    • DRAMP02418

    • Peptide Name

    • Longicin (Ticks, Arthropods, animals)

    • Source

    • Haemaphysalis longicornis (Tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK

    • Sequence Length

    • 38

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiparasitic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02418 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02418.

Physicochemical Information

    • Formula

    • C171H274N60O48S6

    • Absent Amino Acids

    • DEMVW

    • Common Amino Acids

    • G

    • Mass

    • 4130.79

    • PI

    • 9.38

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +8

    • Boman Index

    • -72.74

    • Hydrophobicity

    • -0.44

    • Aliphatic Index

    • 46.32

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 90.68

    • Polar Residues

    • 20

DRAMP02418

DRAMP02418 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Babesial vector tick defensin against Babesia sp. parasites.

    • Reference

    • Infect Immun. 2007 Jul;75(7):3633-3640.

    • Author

    • Tsuji N, Battsetseg B, Boldbaatar D, Miyoshi T, Xuan X, Oliver JH Jr, Fujisaki K.