• DRAMP ID

    • DRAMP02418
    • Peptide Name

    • Longicin (Ticks, Arthropods, animals)
    • Source

    • Haemaphysalis longicornis (Tick)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GFGCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK
    • Sequence Length

    • 38
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiparasitic
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02418 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02418.
    • Formula

    • C171H274N60O48S6
    • Absent Amino Acids

    • DEMVW
    • Common Amino Acids

    • G
    • Mass

    • 4130.79
    • PI

    • 9.38
    • Basic Residues

    • 8
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +8
    • Boman Index

    • -72.74
    • Hydrophobicity

    • -0.44
    • Aliphatic Index

    • 46.32
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 90.68
    • Polar Residues

    • 20

DRAMP02418

DRAMP02418 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Babesial vector tick defensin against Babesia sp. parasites.
    • Reference

    • Infect Immun. 2007 Jul;75(7):3633-3640.
    • Author

    • Tsuji N, Battsetseg B, Boldbaatar D, Miyoshi T, Xuan X, Oliver JH Jr, Fujisaki K.