General Information

    • DRAMP ID

    • DRAMP02419

    • Peptide Name

    • Amblyomma defensin peptide 2 (ADP-2; Ticks, Arthropods, animals)

    • Source

    • Amblyomma hebraeum (Tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YENPYGCPTDEGKCFDRCNDSEFEGGYCGGSYRATCVCYRT

    • Sequence Length

    • 41

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Escherichia coli (MIC=30 µM) and Staphylococcus aureus (MIC=7.5 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Has three disulfide bonds

    • Stereochemistry

    • l

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02419 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02419.

Physicochemical Information

    • Formula

    • C193H275N53O68S6

    • Absent Amino Acids

    • HILMQW

    • Common Amino Acids

    • CG

    • Mass

    • 4617.98

    • PI

    • 4.44

    • Basic Residues

    • 4

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 4

    • Net Charge

    • -3

    • Boman Index

    • -107.07

    • Hydrophobicity

    • -0.929

    • Aliphatic Index

    • 9.51

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7825

    • Absorbance 280nm

    • 195.63

    • Polar Residues

    • 24

DRAMP02419

DRAMP02419 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Two novel non-cationic defensin-like antimicrobial peptides from haemolymph of the female tick, Amblyomma hebraeum.

    • Reference

    • Biochem J. 2004 May 1;379(Pt 3):681-685.

    • Author

    • Lai R, Lomas LO, Jonczy J, Turner PC, Rees HH.