• DRAMP ID

    • DRAMP02420
    • Peptide Name

    • Amblyomma defensin peptide 1 (ADP-1; Ticks, Arthropods, animals)
    • Source

    • Amblyomma hebraeum (Tick)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • FDNPFGCPADEGKCFDHCNNKAYDIGYCGGSYRATCVCYRK
    • Sequence Length

    • 41
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02420 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02420.
    • Formula

    • C197H283N55O61S6
    • Absent Amino Acids

    • LMQW
    • Common Amino Acids

    • C
    • Mass

    • 4590.11
    • PI

    • 6.71
    • Basic Residues

    • 6
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +1
    • Boman Index

    • -83.58
    • Hydrophobicity

    • -0.642
    • Aliphatic Index

    • 23.9
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6335
    • Absorbance 280nm

    • 158.38
    • Polar Residues

    • 20

DRAMP02420

DRAMP02420 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Two novel non-cationic defensin-like antimicrobial peptides from haemolymph of the female tick, Amblyomma hebraeum.
    • Reference

    • Biochem J. 2004 May 1;379(Pt 3):681-685.
    • Author

    • Lai R, Lomas LO, Jonczy J, Turner PC, Rees HH.