General Information

    • DRAMP ID

    • DRAMP02420

    • Peptide Name

    • Amblyomma defensin peptide 1 (ADP-1; Ticks, Arthropods, animals)

    • Source

    • Amblyomma hebraeum (Tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • FDNPFGCPADEGKCFDHCNNKAYDIGYCGGSYRATCVCYRK

    • Sequence Length

    • 41

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02420 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02420.

Physicochemical Information

    • Formula

    • C197H283N55O61S6

    • Absent Amino Acids

    • LMQW

    • Common Amino Acids

    • C

    • Mass

    • 4590.11

    • PI

    • 6.71

    • Basic Residues

    • 6

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +1

    • Boman Index

    • -83.58

    • Hydrophobicity

    • -0.642

    • Aliphatic Index

    • 23.9

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 158.38

    • Polar Residues

    • 20

DRAMP02420

DRAMP02420 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Two novel non-cationic defensin-like antimicrobial peptides from haemolymph of the female tick, Amblyomma hebraeum.

    • Reference

    • Biochem J. 2004 May 1;379(Pt 3):681-685.

    • Author

    • Lai R, Lomas LO, Jonczy J, Turner PC, Rees HH.