• DRAMP ID

    • DRAMP02423
    • Peptide Name

    • HlMS-defensin (Ticks, Arthropods, animals)
    • Source

    • Haemaphysalis longicornis (Tick)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTMIPIRRPPFIMG
    • Sequence Length

    • 48
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus ATCC2592 (MIC=18.8 µg/ml), Bacillus licheniformis (MIC=9.4 µg/ml);
      • Gram-negative bacteria: Escherichia coli ATCC25922 (MIC=28.1 µg/ml), Pseudomonas aeruginosa ATCC27853 (MIC=37.5 µg/ml), Serratia rubidaea (MIC=28.1 µg/ml), Psychrobacter faecalis (MIC=2.3 µg/ml).
      • Fungi: Candida albicans ATCC2002 (MIC=18.8 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02423 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02423.
    • Formula

    • C235H370N70O59S12
    • Absent Amino Acids

    • EHKLNW
    • Common Amino Acids

    • R
    • Mass

    • 5504.68
    • PI

    • 9.21
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +5
    • Boman Index

    • -69.56
    • Hydrophobicity

    • 0.163
    • Aliphatic Index

    • 42.71
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 71.38
    • Polar Residues

    • 17

DRAMP02423

DRAMP02423 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Cloning and characterization of a male-specific defensin-like antimicrobial peptide from the tick Haemaphysalis longicornis.
    • Reference

    • Dev Comp Immunol. 2012 May;37(1):207-211.
    • Author

    • Zheng H, Zhou L, Yang X, Wang D, Liu J.