• • DRAMP ID

  • DRAMP02423

• • Peptide Name

  • HlMS-defensin (Ticks, Arthropods, animals)

• • Source

  • Haemaphysalis longicornis (Tick)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTMIPIRRPPFIMG

• • Sequence Length

  • 48

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-positive bacteria: Staphylococcus aureus ATCC2592 (MIC=18.8 µg/ml), Bacillus licheniformis (MIC=9.4 µg/ml);
    • Gram-negative bacteria: Escherichia coli ATCC25922 (MIC=28.1 µg/ml), Pseudomonas aeruginosa ATCC27853 (MIC=37.5 µg/ml), Serratia rubidaea (MIC=28.1 µg/ml), Psychrobacter faecalis (MIC=2.3 µg/ml).
    • Fungi: Candida albicans ATCC2002 (MIC=18.8 µg/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP02423_predicted_structure.pdb to download.

DRAMP02423

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Cloning and characterization of a male-specific defensin-like antimicrobial peptide from the tick Haemaphysalis longicornis.

• • Pubmed ID

  • 22033149

• • Reference

  • Dev Comp Immunol. 2012 May;37(1):207-211.

• • Author

  • Zheng H, Zhou L, Yang X, Wang D, Liu J.