General Information

    • DRAMP ID

    • DRAMP02425

    • Peptide Name

    • Ixosin-B (Ticks, Arthropods, animals)

    • Source

    • Ixodes sinensis (Hard tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY

    • Sequence Length

    • 32

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • [Ref.18295522]Gram-positive bacterium: Staphylococcus aureus (MIC=2.5 µg/mL);
      • Gram-negative bacterium: Escherichia coli (MIC=15 µg/mL);
      • Yeast: Candida albicans (MIC=7.5 µg/mL).

    • Hemolytic Activity

      • [Ref.18295522]Little hemolytic activity on rabbit red blood cells up to 200 μg/mL

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02425 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02425.

Physicochemical Information

    • Formula

    • C165H262N56O49

    • Absent Amino Acids

    • ACFMN

    • Common Amino Acids

    • RS

    • Mass

    • 3814.24

    • PI

    • 10.88

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +5

    • Boman Index

    • -120.62

    • Hydrophobicity

    • -1.394

    • Aliphatic Index

    • 54.69

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 402.9

    • Polar Residues

    • 10

DRAMP02425

DRAMP02425 chydropathy plot

Comments Information

    • Function

    • Has antifungal and antibacterial activity. Ixosin-B has little hemolytic activity on red blood cells even with peptide

    • concentrations up to 200 µg/mL.

Literature Information

  • ·Literature 1

    • Title

    • Purification and cloning of a novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis.

    • Reference

    • Comp Biochem Physiol B Biochem Mol Biol. 2008 Apr;149(4):557-561.

    • Author

    • Liu Z, Liu H, Liu X, Wu X.