• DRAMP ID

    • DRAMP02426
    • Peptide Name

    • Defensin (Varisin A1; Ticks, Arthropods, animals)
    • Source

    • Dermacentor variabilis (American dog tick)
    • Family

    • Belongs to the invertebrate defensin family (Type 2 subfamily)
    • Gene

    • VSNA1
    • Sequence

    • GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCY
    • Sequence Length

    • 36
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis, Borrelia burgdorferi.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02426 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02426.
    • Formula

    • C163H259N57O47S6
    • Absent Amino Acids

    • DEMVW
    • Common Amino Acids

    • CG
    • Mass

    • 3961.56
    • PI

    • 9.18
    • Basic Residues

    • 7
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +7
    • Boman Index

    • -73.34
    • Hydrophobicity

    • -0.417
    • Aliphatic Index

    • 46.11
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 95.86
    • Polar Residues

    • 20

DRAMP02426

DRAMP02426 chydropathy plot
    • Function

    • Antibacterial activity against Gram-positive and Gram-negative bacteria.
    • PTM

    • Problely contains three disulfide bonds 4-25; 11-33; 15-35.
  • ·Literature 1
    • Title

    • Identification of a defensin from the hemolymph of the American dog tick, Dermacentor variabilis.
    • Reference

    • Insect Biochem Mol Biol. 2001 Jul 26;31(9):857-865.
    • Author

    • Johns R, Sonenshine D.E, Hynes W.L.
  • ·Literature 2
    • Title

    • An arthropod defensin expressed by the hemocytes of the American dog tick, Dermacentor variabilis (Acari: Ixodidae).
    • Reference

    • Insect Biochem Mol Biol. 2003 Nov;33(11):1099-1103.
    • Author

    • Ceraul SM, Sonenshine DE, Ratzlaff RE, Hynes WL.