General Information

    • DRAMP ID

    • DRAMP02426

    • Peptide Name

    • Defensin (Varisin A1; Ticks, Arthropods, animals)

    • Source

    • Dermacentor variabilis (American dog tick)

    • Family

    • Belongs to the invertebrate defensin family (Type 2 subfamily)

    • Gene

    • VSNA1

    • Sequence

    • GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCY

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis, Borrelia burgdorferi.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02426 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02426.

Physicochemical Information

    • Formula

    • C163H259N57O47S6

    • Absent Amino Acids

    • DEMVW

    • Common Amino Acids

    • CG

    • Mass

    • 3961.56

    • PI

    • 9.18

    • Basic Residues

    • 7

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +7

    • Boman Index

    • -73.34

    • Hydrophobicity

    • -0.417

    • Aliphatic Index

    • 46.11

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 95.86

    • Polar Residues

    • 20

DRAMP02426

DRAMP02426 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against Gram-positive and Gram-negative bacteria.

    • PTM

    • Problely contains three disulfide bonds 4-25; 11-33; 15-35.

Literature Information

  • ·Literature 1

    • Title

    • Identification of a defensin from the hemolymph of the American dog tick, Dermacentor variabilis.

    • Reference

    • Insect Biochem Mol Biol. 2001 Jul 26;31(9):857-865.

    • Author

    • Johns R, Sonenshine D.E, Hynes W.L.
  • ·Literature 2

    • Title

    • An arthropod defensin expressed by the hemocytes of the American dog tick, Dermacentor variabilis (Acari: Ixodidae).

    • Reference

    • Insect Biochem Mol Biol. 2003 Nov;33(11):1099-1103.

    • Author

    • Ceraul SM, Sonenshine DE, Ratzlaff RE, Hynes WL.