• DRAMP ID

    • DRAMP02427
    • Peptide Name

    • Ixodes ricinus defensin def1 (Ticks, Arthropods, animals)
    • Source

    • Ixodes ricinus (European tick)
    • Family

    • Not found
    • Gene

    • def1
    • Sequence

    • GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICV
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis (MIC=1.5 µM), Micrococcus luteus(MIC=0.75 µM), Staphylococcus aureus (MRSA) (MIC=50 µM).
    • Hemolytic Activity

      • [Ref.21504572] It has 2.9% and 75% hemolysis at concentrations of 12.5 μM and 100 μM against human erythrocytes .
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys26,Cys12 and Cys34,Cys16 and Cys36.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02427 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02427.
    • Formula

    • C188H279N55O46S6
    • Absent Amino Acids

    • EMNW
    • Common Amino Acids

    • CG
    • Mass

    • 4237.98
    • PI

    • 9.27
    • Basic Residues

    • 9
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +8
    • Boman Index

    • -56
    • Hydrophobicity

    • -0.308
    • Aliphatic Index

    • 31.62
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 134.58
    • Polar Residues

    • 17

DRAMP02427

DRAMP02427 chydropathy plot
    • Function

    • Has antibacterial activity against Gram-positive bacteria.
  • ·Literature 1
    • Title

    • Functional characterization of two defensin isoforms of the hard tick Ixodes ricinus.
    • Reference

    • Parasit Vectors. 2011 Apr 19;4(1):63.
    • Author

    • Chrudimska T, Slaninova J, Ruzek D, Rudenko N, Grubhoffer L.