General Information

    • DRAMP ID

    • DRAMP02428

    • Peptide Name

    • Ixodes ricinus defensin def2 (Ticks, Arthropods, animals)

    • Source

    • Ixodes ricinus (European tick)

    • Family

    • Not found

    • Gene

    • def2

    • Sequence

    • GGYYCPFRQDKCHRHCRSFGRKAGYCGGFLKKTCICV

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis (MIC=0.75 µM), Micrococcus luteus(MIC=0.37 µM), Staphylococcus aureus (MRSA) (MIC=25 µM).

    • Hemolytic Activity

      • [Ref.21504572] It has 2.0% and 64.6% hemolysis at concentrations of 12.5 μM and 100 μM against human erythrocytes .

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys26,Cys12 and Cys34,Cys16 and Cys36.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02428 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02428.

Physicochemical Information

    • Formula

    • C185H282N58O46S6

    • Absent Amino Acids

    • EMNW

    • Common Amino Acids

    • CG

    • Mass

    • 4247

    • PI

    • 9.46

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +9

    • Boman Index

    • -73.9

    • Hydrophobicity

    • -0.505

    • Aliphatic Index

    • 31.62

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 134.58

    • Polar Residues

    • 17

DRAMP02428

DRAMP02428 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against Gram-positive bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Functional characterization of two defensin isoforms of the hard tick Ixodes ricinus.

    • Reference

    • Parasit Vectors. 2011 Apr 19;4(1):63.

    • Author

    • Chrudimska T, Slaninova J, Ruzek D, Rudenko N, Grubhoffer L.