General Information

    • DRAMP ID

    • DRAMP02429

    • Peptide Name

    • Chymotrypsin-elastase inhibitor ixodidin (Ticks, Arthropods, animals)

    • Source

    • Boophilus microplus (Cattle tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QRGSRGQRCGPGEVFNQCGSACPRVCGRPPAQACTLQCVSGCFCRRGYIRTQRGGCIPERQCHQR

    • Sequence Length

    • 65

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Escherichia coli (20% inhibition at 1mM), Micrococcus luteus(MIC=0.12-0.24 mM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • pyroglutamic acid

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys9 and Cys34,Cys18 and Cys42,Cys22 and Cys38,Cys26 and Cys62,Cys44 and Cys56.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02429 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02429.

Physicochemical Information

    • Formula

    • C287H471N109O85S10

    • Absent Amino Acids

    • DKMW

    • Common Amino Acids

    • RCG

    • Mass

    • 7129.18

    • PI

    • 9.53

    • Basic Residues

    • 12

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +10

    • Boman Index

    • -188.37

    • Hydrophobicity

    • -0.722

    • Aliphatic Index

    • 36

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2115

    • Absorbance 280nm

    • 33.05

    • Polar Residues

    • 27

DRAMP02429

DRAMP02429 chydropathy plot

Comments Information

    • Function

    • Inhibits chymotrypsin and elastase. Has antibacterial activity against Gram-positive bacterium M.luteus and the Gram-negative bacterium E. coli.

    • PTM

    • Contains five disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Ixodidin, a novel antimicrobial peptide from the hemocytes of the cattle tick Boophilus microplus with inhibitory activity against serine proteinases.

    • Reference

    • Peptides. 2006 Apr;27(4):667-74.

    • Author

    • Fogaça AC, Almeida IC, Eberlin MN, Tanaka AS, Bulet P, Daffre S.