General Information

    • DRAMP ID

    • DRAMP02433

    • Peptide Name

    • Antimicrobial peptide microplusin (Microplusin; Ticks, Arthropods, animals)

    • Source

    • Boophilus microplus (Cattle tick)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • HHQELCTKGDDALVTELECIRLRISPETNAAFDNAVQQLNCLNRACAYRKMCATNNLEQAMSVYFTNEQIKEIHDAATACDPEAHHEHDH

    • Sequence Length

    • 90

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal, Antibacterial

    • Target Organism

    • Micrococcus luteus (MIC=0.38-0.76 µM), Cryptococcus neoformans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Metal-binding: copper II and iron II

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys6 and Cys52,Cys19 and Cys80,Cys41 and Cys46.

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • Microplusin consists of five alpha-helices: alpha1 (residues Gly-9 to Arg-21), alpha2 (residues Glu-27 to Asn-40), alpha3 (residues Arg-44 to Thr-54), alpha4 (residues Leu-57 to Tyr-64), and alpha5 (residues Asn-67 to Cys-80). The N and C termini are disordered.

    • Helical Wheel Diagram

    • DRAMP02433 helical wheel diagram

    • PDB ID

    • 2KNJ  resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP02433.

Physicochemical Information

    • Formula

    • C429H671N131O143S8

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • A

    • Mass

    • 10208.32

    • PI

    • 5.16

    • Basic Residues

    • 14

    • Acidic Residues

    • 15

    • Hydrophobic Residues

    • 28

    • Net Charge

    • -1

    • Boman Index

    • -212

    • Hydrophobicity

    • -0.616

    • Aliphatic Index

    • 70.67

    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 37.7

    • Polar Residues

    • 24

DRAMP02433

DRAMP02433 chydropathy plot

Comments Information

    • Function

    • Has bacteriostatic activity against the Gram-positive bacterium M.luteus. Has fungistatic activity against C.neoformans. Binds and sequesters copper and iron ions. Copper-chelating is crucial for antimicrobial activity against M.luteus.

    • Tissue specificity

    • Expressed in the hemocytes, fat body and ovaries.

    • PTM

    • Contains three disulfide bonds 6-52; 19-80; 41-46.

Literature Information

  • ·Literature 1

    • Title

    • Cysteine-rich antimicrobial peptides of the cattle tick Boophilus microplus: isolation, structural characterization and tissue expression profile.

    • Reference

    • Dev Comp Immunol. 2004 Mar;28(3):191-200.

    • Author

    • Fogaça AC, Lorenzini DM, Kaku LM, Esteves E, Bulet P, Daffre S.
  • ·Literature 2

    • Title

    • Structure and mode of action of microplusin, a copper II-chelating antimicrobial peptide from the cattle tick Rhipicephalus (Boophilus) microplus.

    • Reference

    • J Biol Chem. 2009 Dec 11;284(50):34735-34746.

    • Author

    • Silva FD, Rezende CA, Rossi DC, Esteves E, Dyszy FH, Schreier S, Gueiros-Filho F, Campos CB, Pires JR, Daffre S.