General Information

    • DRAMP ID

    • DRAMP02435

    • Peptide Name

    • Antifungal protein (PgAFP; Cys-rich)

    • Source

    • Penicillium chrysogenum (Penicillium notatum)

    • Family

    • Not found

    • Gene

    • afp

    • Sequence

    • LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV

    • Sequence Length

    • 58

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiparasitic

    • Target Organism

      • Fungi: Polytrichum commune Pc332, Penicillium echinulatum Pe321, Aspergillus niger An261.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02435 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP02435.

Physicochemical Information

    • Formula

    • C272H431N89O85S6

    • Absent Amino Acids

    • IMW

    • Common Amino Acids

    • K

    • Mass

    • 6500.32

    • PI

    • 8.83

    • Basic Residues

    • 16

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +10

    • Boman Index

    • -152.58

    • Hydrophobicity

    • -1.031

    • Aliphatic Index

    • 43.62

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 58.86

    • Polar Residues

    • 24

DRAMP02435

DRAMP02435 chydropathy plot

Comments Information

    • Function

    • Has strong antifungal activity against the molds Polytrichum commune Pc332, Penicillium echinulatum Pe321, and Aspergillus niger An261.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Characterization of the novel antifungal protein PgAFP and the encoding gene of Penicillium chrysogenum.

    • Reference

    • Peptides. 2010 Apr;31(4):541-547.

    • Author

    • Rodríguez-Martín A, Acosta R, Liddell S, Núñez F, Benito MJ, Asensio MA.
  • ·Literature 2

    • Title

    • Selection of antifungal protein-producing molds from dry-cured meat products.

    • Reference

    • Int J Food Microbiol. 2009 Sep 30;135(1):39-46.

    • Author

    • Acosta R, Rodríguez-Martín A, Martín A, Núñez F, Asensio MA.