• • DRAMP ID

  • DRAMP02437

• • Peptide Name

  • Papillosin

• • Source

  • Halocynthia papillosa (Red sea-squirt)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ

• • Sequence Length

  • 34

• • UniProt Entry

  • P86416

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • [Ref.19085906]Gram-positive bacteria (Native, Synthetic): Micrococcus luteus A270 (MBC=0.13-0.25, 0.19-0.39 µM), Aerococcus viridans 54.145 T (MBC=ND, 0.19-0.39 µM), Bacillus megaterium 66.20 T (MBC=ND, 0.05-0.10 µM), Staphylococcus aureus 65.8 T (MBC=0.5-1.00, 1.56-3.13 µM), Enterococcus faecalis 103015 T (MBC=ND, 0.78-1.56 µM);
    • Gram-negative bacteria (Native, Synthetic): Enterobacter aerogenes 30.86 T (MBC=ND, 0.78-1.56 µM), Pseudomonas aeruginosa 100720 T (MBC=ND, 3.13-6.25 µM), Salmonella thyphimurium 60.62 T (MBC=ND, 0.78-1.56 µM), Klebsiella pneumoniae 82.91 T (MBC=ND, 0.39-0.78 µM), Escherichia coli (MBC=0.25-0.50, 0.78-1.56 µM)

• • Hemolytic Activity

  • • [Ref.19085906]0% hemolytic activity at 50 μM against sheep erythrocytes

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02437.

DRAMP02437

• • Function

  • Has strong antibacterial activity against the Gram-positive bacteria M. luteus, S. aureus, B. megaterium, A. viridans and E. faecalis, and against the Gram-negative bacteria K. pneumoniae, E. coli DH5alpha, S. typhimurium, P. aeruginosa and E. aerogenes. Lacks hemolytic activity against sheep erythrocytes.

• ·Literature 1

• • Title

  • Halocyntin and papillosin, two new antimicrobial peptides isolated from hemocytes of the solitary tunicate, Halocynthia papillosa.

• • Pubmed ID

  • 19085906

• • Reference

  • J Pept Sci. 2009 Jan;15(1):48-55.

• • Author

  • Galinier R, Roger E, Sautiere PE, Aumelas A, Banaigs B, Mitta G.