General Information

    • DRAMP ID

    • DRAMP02451

    • Peptide Name

    • Lysozyme C (1,4-beta-N-acetylmuramidase C)

    • Source

    • Pseudocheirus peregrinus (Common ring-tailed possum)

    • Family

    • Belongs to the glycosyl hydrolase 22 family

    • Gene

    • LYZ

    • Sequence

    • SKMKKCEFAKIAKEQHMDGYHGVSLADWVCLVNNESDFNTKAINRNKGI

    • Sequence Length

    • 49

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02451 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02451.

Physicochemical Information

    • Formula

    • C242H384N70O73S4

    • Absent Amino Acids

    • P

    • Common Amino Acids

    • K

    • Mass

    • 5570.38

    • PI

    • 8.68

    • Basic Residues

    • 10

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • -99

    • Hydrophobicity

    • -0.641

    • Aliphatic Index

    • 65.71

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 148.23

    • Polar Residues

    • 15

DRAMP02451

DRAMP02451 chydropathy plot

Comments Information

    • Function

    • Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents By similarity.

    • Catalytic activity

    • Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.

    • Miscellaneous

    • Lysozyme C is capable of both hydrolysis and transglycosylation; it shows also a slight esterase activity. It acts rapidly on both peptide-substituted and unsubstituted peptidoglycan, and slowly on chitin oligosaccharides By similarity.

Literature Information

  • ·Literature 1

    • Title

    • Isolation, partial sequence and asynchronous appearance during lactation of lysozyme and alpha-lactalbumin in the milk of a marsupial, the common ringtail possum (Pseudocheirus peregrinus).

    • Reference

    • Comp Biochem Physiol B. 1989;94(4):775-778.

    • Author

    • Nicholas K, Loughnan M, Messer M, Munks S, Griffiths M, Shaw D.